MARCH10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198327

Catalog No. NBP198327

Description

44265 Polyclonal specifically detects 44265 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: MARCH10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.3.2.-, FLJ35757, MARCH-Xprobable E3 ubiquitin-protein ligase MARCH10, membrane-associated ring finger (C3HC4) 10, Membrane-associated RING finger protein 10, Membrane-associated RING-CH protein X, RING finger protein 190RNF190
• Host Species: Rabbit
• Molecular Weight of Antigen: 86 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Rabbit: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001013995
• Gene Symbols: 43169
• Immunogen: The immunogen for this antibody is rat MARCH10 (Q5XIV2) - C-terminal region. Peptide sequence QRFAELMTLNYRRASRERMSRNYPQPRPEESESSESGDGNESNVYPGRVI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 162333
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.