Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MARCH10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19832720UL
Description
44265 Polyclonal specifically detects 44265 in Rat samples. It is validated for Western Blot.Specifications
| MARCH10 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_001013995 | |
| 43169 | |
| The immunogen for this antibody is MARCH10 - C-terminal region. Peptide sequence QRFAELMTLNYRRASRERMSRNYPQPRPEESESSESGDGNESNVYPGRVI. | |
| Affinity Purified | |
| RUO | |
| 162333 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| EC 6.3.2.-, FLJ35757, MARCH-Xprobable E3 ubiquitin-protein ligase MARCH10, membrane-associated ring finger (C3HC4) 10, Membrane-associated RING finger protein 10, Membrane-associated RING-CH protein X, RING finger protein 190RNF190 | |
| Rabbit | |
| 86 kDa | |
| 20 μL | |
| Primary | |
| Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction