Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MARCH10 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19832720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19832720 20 μL
NBP198327 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19832720 Supplier Novus Biologicals Supplier No. NBP19832720UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

44265 Polyclonal specifically detects 44265 in Rat samples. It is validated for Western Blot.

Specifications

Antigen MARCH10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_001013995
Gene Alias EC 6.3.2.-, FLJ35757, MARCH-Xprobable E3 ubiquitin-protein ligase MARCH10, membrane-associated ring finger (C3HC4) 10, Membrane-associated RING finger protein 10, Membrane-associated RING-CH protein X, RING finger protein 190RNF190
Gene Symbols 43169
Host Species Rabbit
Immunogen The immunogen for this antibody is MARCH10 - C-terminal region. Peptide sequence QRFAELMTLNYRRASRERMSRNYPQPRPEESESSESGDGNESNVYPGRVI.
Molecular Weight of Antigen 86 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 162333
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.