ZNF667 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198333

Catalog No. NBP198333

Description

ZNF667 Polyclonal specifically detects ZNF667 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF667
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686O111, FLJ14011, FLJ45518, MIPU1, myocardial ischemic preconditioning upregulated 1 ortholog, zinc finger protein 667
• Host Species: Rabbit
• Molecular Weight of Antigen: 66 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%; Mouse: 86%; Equine: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001008557
• Gene Symbols: ZNF667
• Immunogen: The immunogen for this antibody is Znf667 - N-terminal region. Peptide sequence MPAARGKSKSKAPVTFGDLAIYFSQEEWEWLSPNQKDLYEDVMLENYHNL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 63934
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.