Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF667 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF667 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF667 Polyclonal specifically detects ZNF667 in Rat samples. It is validated for Western Blot.Specifications
ZNF667 | |
Polyclonal | |
Rabbit | |
NP_001008557 | |
63934 | |
The immunogen for this antibody is Znf667 - N-terminal region. Peptide sequence MPAARGKSKSKAPVTFGDLAIYFSQEEWEWLSPNQKDLYEDVMLENYHNL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp686O111, FLJ14011, FLJ45518, MIPU1, myocardial ischemic preconditioning upregulated 1 ortholog, zinc finger protein 667 | |
ZNF667 | |
IgG | |
66 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title