Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    MED7 Antibody, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19833920UL
Description
MED7 Polyclonal specifically detects MED7 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Chromatin Immunoprecipitation (ChIP).Specifications
| MED7 | |
| Polyclonal | |
| Western Blot 1:1000, Chromatin Immunoprecipitation 1:10-1:500 | |
| NP_004261 | |
| MED7 | |
| The immunogen for this antibody is MED7 - C-terminal region. Peptide sequence LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE. | |
| Affinity Purified | |
| RUO | |
| 9443 | |
| Store at -20C. Avoid freeze-thaw cycles. | 
| ChIP Assay | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| Activator-recruited cofactor 34 kDa component, Cofactor required for Sp1 transcriptional activation subunit 9, cofactor required for Sp1 transcriptional activation, subunit 9 (33kD), cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa, CRSP33CRSP complex subunit 9, CRSP9hMED7, mediator complex subunit 7ARC34, mediator of RNA polymerase II transcription subunit 7, MGC12284, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33 | |
| Rabbit | |
| 27 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            Spot an opportunity for improvement?Share a Content Correction