Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MED7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | MED7 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19833920
|
Novus Biologicals
NBP19833920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198339
|
Novus Biologicals
NBP198339 |
100 μL |
Each for $487.50
|
|
|||||
Description
MED7 Polyclonal specifically detects MED7 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Chromatin Immunoprecipitation (ChIP).Specifications
| MED7 | |
| Unconjugated | |
| RUO | |
| Activator-recruited cofactor 34 kDa component, Cofactor required for Sp1 transcriptional activation subunit 9, cofactor required for Sp1 transcriptional activation, subunit 9 (33kD), cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa, CRSP33CRSP complex subunit 9, CRSP9hMED7, mediator complex subunit 7ARC34, mediator of RNA polymerase II transcription subunit 7, MGC12284, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33 | |
| MED7 | |
| IgG | |
| 27 kDa |
| Polyclonal | |
| Rabbit | |
| NP_004261 | |
| 9443 | |
| The immunogen for this antibody is MED7 - C-terminal region. Peptide sequence LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title