Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HPRT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19835920UL
Description
HPRT Polyclonal specifically detects HPRT in Mouse samples. It is validated for Western Blot.Specifications
HPRT | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
P00493 | |
HPRT1 | |
Peptide sequence (SRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA) corresponding to aa 169-218 from C-terminal region of mouse HPRT (NP_038584). | |
Affinity Purified | |
RUO | |
3251 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 2.4.2.8, HGPRTHPRTHGPRTase, hypoxanthine phosphoribosyltransferase 1, hypoxanthine-guanine phosphoribosyltransferase | |
Rabbit | |
24 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction