Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Olfr329-ps Antibody, Novus Biologicals™

Olfr329-ps Antibody, Novus Biologicals™
SDP

Catalog No. NBP19826720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19826720 20 μL
NBP198267 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19826720 Supplier Novus Biologicals Supplier No. NBP19826720UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

Olfr329-ps Polyclonal specifically detects Olfr329-ps in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Olfr329-ps
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001011531
Gene Alias olfactory receptor 2T4, olfactory receptor, family 2, subfamily T, member 4, OR1-60, OR2T4Q
Gene Symbols OR2T4
Host Species Rabbit
Immunogen The immunogen for this antibody is Olfr329-ps - middle region. Peptide sequence TVLRMNSAEGRKKALATCSSHMTVVTLFYGAAVYTYMLPASLHTPEKDMV.
Molecular Weight of Antigen 54 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 127074
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.