Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PFTK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198270
Description
PFTK1 Polyclonal specifically detects PFTK1 in Mouse samples. It is validated for Western Blot.Specifications
PFTK1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Cell division protein kinase 14, cyclin-dependent kinase 14, EC 2.7.11, KIAA0834EC 2.7.11.22, PFTAIRE1hPFTAIRE1, PFTK1PFTAIRE protein kinase 1, Serine/threonine-protein kinase PFTAIRE-1 | |
Rabbit | |
Affinity purified | |
RUO | |
5218 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_035204 | |
CDK14 | |
The immunogen for this antibody is Cdk14 - C-terminal region. Peptide sequence SDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%; Xenopus: 85%; Chicken: 85%. | |
Human, Mouse, Rat, Pig, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction