Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PFTK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PFTK1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PFTK1 Polyclonal specifically detects PFTK1 in Mouse samples. It is validated for Western Blot.Specifications
PFTK1 | |
Polyclonal | |
Rabbit | |
NP_035204 | |
5218 | |
The immunogen for this antibody is Cdk14 - C-terminal region. Peptide sequence SDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Cell division protein kinase 14, cyclin-dependent kinase 14, EC 2.7.11, KIAA0834EC 2.7.11.22, PFTAIRE1hPFTAIRE1, PFTK1PFTAIRE protein kinase 1, Serine/threonine-protein kinase PFTAIRE-1 | |
CDK14 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title