SERPINB12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198386

Catalog No. NBP198386

Description

SERPINB12 Polyclonal specifically detects SERPINB12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SERPINB12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC119247, MGC119248, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 12, serpin B12, serpin peptidase inhibitor, clade B (ovalbumin), member 12, YUKOPIN
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Bovine: 79%.
• Target Species: Human, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_536722
• Gene Symbols: SERPINB12
• Immunogen: The immunogen for this antibody is SERPINB12 - N-terminal. Peptide sequence LGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSNKQKAGSLNNE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 89777
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.