Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SERPINB12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SERPINB12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SERPINB12 Polyclonal specifically detects SERPINB12 in Human samples. It is validated for Western Blot.Specifications
SERPINB12 | |
Polyclonal | |
Rabbit | |
NP_536722 | |
89777 | |
The immunogen for this antibody is SERPINB12 - N-terminal. Peptide sequence LGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSNKQKAGSLNNE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC119247, MGC119248, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 12, serpin B12, serpin peptidase inhibitor, clade B (ovalbumin), member 12, YUKOPIN | |
SERPINB12 | |
IgG | |
46 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title