Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ROR1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19839520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19839520 20 μL
NBP198395 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19839520 Supplier Novus Biologicals Supplier No. NBP19839520UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

ROR1 Polyclonal specifically detects ROR1 in Human samples. It is validated for Western Blot.

Specifications

Antigen ROR1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_005003
Gene Alias EC 2.7.10.1, MGC99659, neurotrophic tyrosine kinase receptor-related 1, Neurotrophic tyrosine kinase, receptor-related 1, NTRKR1dJ537F10.1, receptor tyrosine kinase-like orphan receptor 1, tyrosine-protein kinase transmembrane receptor ROR1
Gene Symbols ROR1
Host Species Rabbit
Immunogen The immunogen for this antibody is ROR1 - N-terminal region. Peptide sequence TASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITA.
Molecular Weight of Antigen 104 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 4919
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.