Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
eIF3K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198396
Description
eIF3K Polyclonal specifically detects eIF3K in Mouse samples. It is validated for Western Blot.Specifications
eIF3K | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ARG134, eIF3k, EIF3-p28, EIF3S12eIF-3 p28, Eukaryotic translation initiation factor 3 subunit 12, eukaryotic translation initiation factor 3 subunit K, eukaryotic translation initiation factor 3, subunit 12, eukaryotic translation initiation factor 3, subunit K, HSPC029, M9, MSTP001, muscle specific, Muscle-specific gene M9 protein, PLAC24, PLAC-24, PLAC-24eIF-3 p25, PRO1474, PTD001 | |
Rabbit | |
25 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_082935 | |
EIF3K | |
The immunogen for this antibody is Eif3k - N-terminal region. Peptide sequence QILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAF. | |
Affinity purified | |
RUO | |
27335 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction