Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

eIF3K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	eIF3K
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP198396 View Documents View Product Certificates	Novus Biologicals NBP198396	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

eIF3K Polyclonal specifically detects eIF3K in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	eIF3K
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_082935
Gene ID (Entrez)	27335
Immunogen	The immunogen for this antibody is Eif3k - N-terminal region. Peptide sequence QILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAF.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	ARG134, eIF3k, EIF3-p28, EIF3S12eIF-3 p28, Eukaryotic translation initiation factor 3 subunit 12, eukaryotic translation initiation factor 3 subunit K, eukaryotic translation initiation factor 3, subunit 12, eukaryotic translation initiation factor 3, subunit K, HSPC029, M9, MSTP001, muscle specific, Muscle-specific gene M9 protein, PLAC24, PLAC-24, PLAC-24eIF-3 p25, PRO1474, PTD001
Gene Symbols	EIF3K
Isotype	IgG
Molecular Weight of Antigen	25 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

eIF3K Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents