CD84/SLAMF5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198409

Catalog No. NBP198409

Description

CD84/SLAMF5 Polyclonal specifically detects CD84/SLAMF5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CD84/SLAMF5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CD84 antigen, CD84 antigen (leukocyte antigen), CD84 molecule, Cell surface antigen MAX.3, DKFZp781E2378, hCD84, hly9-beta, leucocyte differentiation antigen CD84, leukocyte antigen CD84, Leukocyte differentiation antigen CD84, mCD84, Signaling lymphocytic activation molecule 5, SLAM family member 5, SLAMF5LY9B
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 92%.
• Target Species: Human, Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_003865
• Gene Symbols: CD84
• Immunogen: The immunogen for this antibody is CD84 - C-terminal region. Peptide sequence: YDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8832
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.