BRAF35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198256

Catalog No. NBP198256

Description

BRAF35 Polyclonal specifically detects BRAF35 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: BRAF35
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BRAF35Sox-like transcriptional factor, high-mobility group 20B, HMG domain-containing protein 2, HMG domain-containing protein HMGX2, HMGX2FLJ26127, HMGXB2member 1-related, SMARCE1R, SMARCE1-related protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10362
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001102201
• Gene Symbols: HMG20B
• Immunogen: The immunogen for this antibody is Hmg20b. Peptide sequence TKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTEKI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Xenopus: 92%; Mouse: 92%; Rat: 92%; Zebrafish: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG