Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRAF35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | BRAF35 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
BRAF35 Polyclonal specifically detects BRAF35 in Rat samples. It is validated for Western Blot.Specifications
| BRAF35 | |
| Polyclonal | |
| Rabbit | |
| NP_001102201 | |
| 10362 | |
| The immunogen for this antibody is Hmg20b. Peptide sequence TKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTEKI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BRAF35Sox-like transcriptional factor, high-mobility group 20B, HMG domain-containing protein 2, HMG domain-containing protein HMGX2, HMGX2FLJ26127, HMGXB2member 1-related, SMARCE1R, SMARCE1-related protein | |
| HMG20B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title