Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VAC14 Rabbit anti-Human, Polyclonal, Novus Biologicals™

VAC14 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB159954 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB159954 100 μg
NB159955 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB159954 Supplier Novus Biologicals Supplier No. NBP317962100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

VAC14 Polyclonal antibody specifically detects VAC14 in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen VAC14
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias ArPIKfyve, FLJ10305, FLJ36622, MGC149816, protein VAC14 homolog, Tax1 (human T-cell leukemia virus type I) binding protein 1, Tax1 (human T-cell leukemia virus type I) binding protein 2, Tax1-binding protein 2, TAX1BP2FLJ46582, TRXMGC149815, Vac14 homolog (S. cerevisiae)
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: IECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEV
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 55697
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.