Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VAMP3/Cellubrevin Rabbit anti-Human, Mouse, Clone: 2H8R8, Novus Biologicals™

VAMP3/Cellubrevin Rabbit anti-Human, Mouse, Clone: 2H8R8, Novus Biologicals™
SDP

Catalog No. NB168501 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168501 100 μg
NB168502 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB168501 Supplier Novus Biologicals Supplier No. NBP316705100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

VAMP3/Cellubrevin Monoclonal antibody specifically detects VAMP3/Cellubrevin in Human, Mouse samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen VAMP3/Cellubrevin
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 2H8R8
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias CEBCellubrevin, cellubrevin, SYB3, Synaptobrevin-3, VAMP-3, vesicle-associated membrane protein 3, vesicle-associated membrane protein 3 (cellubrevin)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human VAMP3/Cellubrevin (Q15836). MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Membrane Trafficking and Chaperones, Neuronal Cell Markers, Neurotransmission
Primary or Secondary Primary
Gene ID (Entrez) 9341
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.