VAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157008

Catalog No. NBP157008

Description

VAT1 Polyclonal specifically detects VAT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: VAT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ20230, membrane protein of cholinergic synaptic vesicles, synaptic vesicle membrane protein VAT-1 homolog, VATI, vesicle amine transport protein 1 homolog (T. californica)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Chicken: 91%; Zebrafish: 85%; Xenopus: 84%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q99536
• Gene Symbols: VAT1
• Immunogen: Synthetic peptides corresponding to VAT1 (vesicle amine transport protein 1 homolog (T. californica)) The peptide sequence was selected from the N terminal of VAT1. Peptide sequence PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA.
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 10493
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only