Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VEGF Antibody, Novus Biologicals™

VEGF Antibody, Novus Biologicals™
SDP

Catalog No. NB392739 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392739 25 μL
NBP276563 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB392739 Supplier Novus Biologicals Supplier No. NBP27656325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

VEGF Polyclonal specifically detects VEGF in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen VEGF
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias MVCD1, vascular endothelial growth factor A, Vascular permeability factor, VEGF-A, VEGFMGC70609, VPFvascular endothelial growth factor
Gene Symbols VEGFA
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Cellular Markers, GPCR, HIF Target Genes, Hypoxia, Metastasis, Neuroscience, Neurotransmission, Sensory Systems, Signal Transduction, Vision
Primary or Secondary Primary
Gene ID (Entrez) 7422.0
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.