Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VEGFR1/Flt-1 Antibody (CL0345), Novus Biologicals™
SDP

Catalog No. NB437325 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB437325 25 μL
NBP230982 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB437325 Supplier Novus Biologicals Supplier No. NBP23098225UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

VEGFR1/Flt-1 Monoclonal specifically detects VEGFR1/Flt-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen VEGFR1/Flt-1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL0345
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No. P17948
Gene Alias EC 2.7.10, EC 2.7.10.1, FLT, FLT-1, Fms-like tyrosine kinase 1, fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascularpermeability factor receptor), FRT, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, vascular endothelial growth factor receptor 1, Vascular permeability factor receptor, VEGFR1, VEGFR-1
Gene Symbols FLT1
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGS
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Cancer, Cellular Markers, Endothelial Cell Markers, HIF Target Genes, Hypoxia, Signal Transduction, Stem Cell Markers, Tumor Suppressors, Tyrosine Kinases
Primary or Secondary Primary
Gene ID (Entrez) 2321
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.