VHR/DUSP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25738725UL

Catalog No. NB403475

Description

VHR/DUSP3 Polyclonal specifically detects VHR/DUSP3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: VHR/DUSP3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: dual specificity phosphatase 3, dual specificity protein phosphatase 3, Dual specificity protein phosphatase VHR, EC 3.1.3.16, EC 3.1.3.48, Vaccinia H1-related phosphatase, vaccinia virus phosphatase VH1-related, VHRserine/threonine specific protein phosphatase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DUSP3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
• Quantity: 25 μL
• Research Discipline: Cancer, Protein Phosphatase
• Gene ID (Entrez): 1845
• Target Species: Human
• Form: Purified

For Research Use Only