Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VIAAT/SLC32A1/VGAT Antibody (CL2793), Novus Biologicals™

VIAAT/SLC32A1/VGAT Antibody (CL2793), Novus Biologicals™
SDP

Catalog No. NB396383 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396383 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396383 Supplier Novus Biologicals Supplier No. NBP24662825UL
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

VIAAT/SLC32A1/VGAT Monoclonal antibody specifically detects VIAAT/SLC32A1/VGAT in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen VIAAT/SLC32A1/VGAT
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL2793
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. Q9H598
Gene Alias bA122O1.1, hVIAAT, solute carrier family 32 (GABA vesicular transporter), member 1, Solute carrier family 32 member 1, Vesicular GABA transporter, vesicular inhibitory amino acid transporter, VGATGABA and glycine transporter, VIAAT
Host Species Mouse
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Neuroscience, Neurotransmission
Primary or Secondary Primary
Gene ID (Entrez) 140679
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.