Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VISTA/B7-H5/PD-1H Antibody (CL3981), Novus Biologicals™
SDP

Catalog No. NB403062 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403062 25 μL
NBP259031 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403062 Supplier Novus Biologicals Supplier No. NBP25903125UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

VISTA/B7-H5/PD-1H Monoclonal specifically detects VISTA/B7-H5/PD-1H in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen VISTA/B7-H5/PD-1H
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:1000 - 1:2000
Formulation PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Alias B7H5, B7-H5, C10orf54, chromosome 10 open reading frame 54, GI24, platelet receptor Gi24, PP2135, SISP1, stress induced secreted protein 1, VSIR
Gene Symbols C10ORF54
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 64115
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.