VISTA/B7-H5/PD-1H Antibody (CL3981), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP259031

Catalog No. NBP259031

Description

VISTA/B7-H5/PD-1H Monoclonal specifically detects VISTA/B7-H5/PD-1H in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: VISTA/B7-H5/PD-1H
• Classification: Monoclonal
• Dilution: Immunohistochemistry-Paraffin 1:1000 - 1:2000
• Gene Alias: B7H5, B7-H5, C10orf54, chromosome 10 open reading frame 54, GI24, platelet receptor Gi24, PP2135, SISP1, stress induced secreted protein 1, VSIR
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: C10ORF54
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
• Quantity: 100 μL
• Research Discipline: Cancer, Cardiovascular Biology, Immunology
• Gene ID (Entrez): 64115
• Target Species: Human
• Form: Purified

For Research Use Only