Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VN1R1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

VN1R1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB123831 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB123831 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB123831 Supplier Novus Biologicals Supplier No. NBP309465100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

VN1R1 Polyclonal specifically detects VN1R1 in Human samples. It is validated for Western Blot.

Specifications

Antigen VN1R1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias G-protein coupled receptor GPCR24, V1RL1hGPCR24, V1R-like 1, V1r-like receptor 1, V3r-related gene protein, VNR19I1, vomeronasal 1 receptor 1, Vomeronasal olfactory receptor chromosome 19 subtype I member 1, vomeronasal olfactory receptor, (chromosome 19) subtype I, member 1, vomeronasal type-1 receptor 1, ZVNH1, ZVNR1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human VN1R1 (NP_065684). Peptide sequence VQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVANP
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Olfactory
Primary or Secondary Primary
Gene ID (Entrez) 57191
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.