Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VN1R1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309465100UL
Description
VN1R1 Polyclonal specifically detects VN1R1 in Human samples. It is validated for Western Blot.Specifications
VN1R1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
G-protein coupled receptor GPCR24, V1RL1hGPCR24, V1R-like 1, V1r-like receptor 1, V3r-related gene protein, VNR19I1, vomeronasal 1 receptor 1, Vomeronasal olfactory receptor chromosome 19 subtype I member 1, vomeronasal olfactory receptor, (chromosome 19) subtype I, member 1, vomeronasal type-1 receptor 1, ZVNH1, ZVNR1 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human VN1R1 (NP_065684). Peptide sequence VQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVANP | |
100 μg | |
Olfactory | |
57191 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction