Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VN1R1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | VN1R1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
VN1R1 Polyclonal specifically detects VN1R1 in Human samples. It is validated for Western Blot.Specifications
| VN1R1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Olfactory | |
| PBS buffer, 2% sucrose | |
| 57191 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| G-protein coupled receptor GPCR24, V1RL1hGPCR24, V1R-like 1, V1r-like receptor 1, V3r-related gene protein, VNR19I1, vomeronasal 1 receptor 1, Vomeronasal olfactory receptor chromosome 19 subtype I member 1, vomeronasal olfactory receptor, (chromosome 19) subtype I, member 1, vomeronasal type-1 receptor 1, ZVNH1, ZVNR1 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human VN1R1 (NP_065684). Peptide sequence VQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVANP | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title