Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VNN2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179906
Description
VNN2 Polyclonal specifically detects VNN2 in Human samples. It is validated for Western Blot.Specifications
VNN2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 3.5.1, EC 3.5.1.92, FOAP-4, Glycosylphosphatidyl inositol-anchored protein GPI-80, GPI-80, GPI-80 variant protein 1, GPI-80 variant protein 2, GPI-80 variant protein 3, GPI-80 variant protein 4, pantetheinase, Protein FOAP-4, vanin 2, vanin-2, Vannin 2, vascular non-inflammatory molecule 2 | |
Rabbit | |
57 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Dog: 89%; Horse: 86%; Sheep: 86%; Bovine: 79%; Zebrafish: 75%. | |
Human, Pig, Bovine, Canine, Equine, Sheep, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_004656 | |
VNN2 | |
The immunogen for this antibody is VNN2. Peptide sequence FRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGA. | |
Affinity purified | |
RUO | |
8875 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction