Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VNN2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | VNN2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
VNN2 Polyclonal specifically detects VNN2 in Human samples. It is validated for Western Blot.Specifications
| VNN2 | |
| Polyclonal | |
| Rabbit | |
| NP_004656 | |
| 8875 | |
| The immunogen for this antibody is VNN2. Peptide sequence FRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.5.1, EC 3.5.1.92, FOAP-4, Glycosylphosphatidyl inositol-anchored protein GPI-80, GPI-80, GPI-80 variant protein 1, GPI-80 variant protein 2, GPI-80 variant protein 3, GPI-80 variant protein 4, pantetheinase, Protein FOAP-4, vanin 2, vanin-2, Vannin 2, vascular non-inflammatory molecule 2 | |
| VNN2 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title