VPS37C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156409

Catalog No. NBP156409

Description

VPS37C Polyclonal specifically detects VPS37C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: VPS37C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ESCRT-I complex subunit VPS37C, FLJ20847, hVps37C, PML39, vacuolar protein sorting 37 homolog C (S. cerevisiae), vacuolar protein sorting 37C, vacuolar protein sorting 37C (yeast), vacuolar protein sorting-associated protein 37C
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55048
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A5D8V6
• Gene Symbols: VPS37C
• Immunogen: Synthetic peptides corresponding to VPS37C(vacuolar protein sorting 37 homolog C (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS37C. Peptide sequence LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Rat: 100%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG