Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VPS37C Antibody, Novus Biologicals™

VPS37C Antibody, Novus Biologicals™
SDP

Catalog No. NBP15640920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15640920 20 μL
NBP156409 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15640920 Supplier Novus Biologicals Supplier No. NBP15640920UL

Description

Rabbit Polyclonal Antibody

VPS37C Polyclonal specifically detects VPS37C in Human samples. It is validated for Western Blot.

Specifications

Antigen VPS37C
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. A5D8V6
Gene Alias ESCRT-I complex subunit VPS37C, FLJ20847, hVps37C, PML39, vacuolar protein sorting 37 homolog C (S. cerevisiae), vacuolar protein sorting 37C, vacuolar protein sorting 37C (yeast), vacuolar protein sorting-associated protein 37C
Gene Symbols VPS37C
Host Species Rabbit
Immunogen Synthetic peptides corresponding to VPS37C(vacuolar protein sorting 37 homolog C (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS37C. Peptide sequence LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55048
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.