Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VPS37C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15640920UL
Description
VPS37C Polyclonal specifically detects VPS37C in Human samples. It is validated for Western Blot.Specifications
| VPS37C | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| A5D8V6 | |
| VPS37C | |
| Synthetic peptides corresponding to VPS37C(vacuolar protein sorting 37 homolog C (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS37C. Peptide sequence LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ESCRT-I complex subunit VPS37C, FLJ20847, hVps37C, PML39, vacuolar protein sorting 37 homolog C (S. cerevisiae), vacuolar protein sorting 37C, vacuolar protein sorting 37C (yeast), vacuolar protein sorting-associated protein 37C | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 55048 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction