Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VPS52 Antibody, Novus Biologicals™

VPS52 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15762820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15762820 20 μL
NBP157628 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15762820 Supplier Novus Biologicals Supplier No. NBP15762820UL

Description

Rabbit Polyclonal Antibody

VPS52 Polyclonal specifically detects VPS52 in Human samples. It is validated for Western Blot.

Specifications

Antigen VPS52
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/m
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N1B4
Gene Alias ARE1, dJ1033B10.5, DKFZp547I194, SAC2, SAC2 suppressor of actin mutations 2-like (yeast), SAC2 suppressor of actin mutations 2-like protein, SACM2LRP5-1033B10, vacuolar protein sorting 52 (yeast), vacuolar protein sorting 52 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 52 homolog
Gene Symbols VPS52
Host Species Rabbit
Immunogen Synthetic peptides corresponding to VPS52 (vacuolar protein sorting 52 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of VPS52)(50ug). Peptide sequence RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cellular Markers
Primary or Secondary Primary
Gene ID (Entrez) 6293
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.