VSIG3/IGSF11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159503

Catalog No. NBP159503

Description

VSIG3/IGSF11 Polyclonal specifically detects VSIG3/IGSF11 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: VSIG3/IGSF11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Brain and testis-specific immunoglobulin superfamily protein, Bt-IGSF, BTIGSF, cancer/testis antigen 119, CT119, CXADR like 1, CXADRL1, IgSF11, Igsf13, immunoglobulin superfamily member 11, immunoglobulin superfamily, member 11, MGC35227, V-set and immunoglobulin domain containing 3, V-set and immunoglobulin domain-containing protein 3, VSIG3brain and testis-specific immunoglobin superfamily protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 152404
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5DX21
• Gene Symbols: IGSF11
• Immunogen: Synthetic peptides corresponding to IGSF11(immunoglobulin superfamily, member 11) The peptide sequence was selected from the middle region of IGSF11. Peptide sequence EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG