Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VSIG3/IGSF11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15950320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15950320 20 μL
NBP159503 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15950320 Supplier Novus Biologicals Supplier No. NBP15950320UL

Rabbit Polyclonal Antibody

VSIG3/IGSF11 Polyclonal specifically detects VSIG3/IGSF11 in Human samples. It is validated for Western Blot.

Specifications

Antigen VSIG3/IGSF11
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5DX21
Gene Alias Brain and testis-specific immunoglobulin superfamily protein, Bt-IGSF, BTIGSF, cancer/testis antigen 119, CT119, CXADR like 1, CXADRL1, IgSF11, Igsf13, immunoglobulin superfamily member 11, immunoglobulin superfamily, member 11, MGC35227, V-set and immunoglobulin domain containing 3, V-set and immunoglobulin domain-containing protein 3, VSIG3brain and testis-specific immunoglobin superfamily protein
Gene Symbols IGSF11
Host Species Rabbit
Immunogen Synthetic peptides corresponding to IGSF11(immunoglobulin superfamily, member 11) The peptide sequence was selected from the middle region of IGSF11. Peptide sequence EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 152404
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.