Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WBP11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP180988 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180988 0.1 mL
NB434002 25ul
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP180988 Supplier Novus Biologicals Supplier No. NBP180988
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

WBP11 Polyclonal specifically detects WBP11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen WBP11
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9Y2W2
Gene Alias DKFZp779M1063, Npw38-binding protein, Npw38-binding protein NpwBP, NpwBP, NPWBPsplicing factor, PQBP1 and PP1 interacting, SH3 domain-binding protein SNP70, SIPP1WW domain-binding protein 11, SNP70, Splicing factor that interacts with PQBP-1 and PP1, WBP-11, WW domain binding protein 11
Gene Symbols WBP11
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYE
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 51729
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.