WBSCR22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP21352025UL

Catalog No. NB438474

Description

WBSCR22 Polyclonal specifically detects WBSCR22 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: WBSCR22
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: EC 2.1.1.-, FLJ44236, HASJ4442, HUSSY-3, MGC19709, MGC2022, MGC5140, PP3381, WBMT, Williams Beuren syndrome chromosome region 22, Williams Beuren syndrome chromosome region 22 protein, Williams-Beuren candidate region putative methyltransferase, Williams-Beuren syndrome chromosomal region 22 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114049
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: WBSCR22
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only