Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WBSCR27 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31755825UL
This item is not returnable.
View return policy
Description
WBSCR27 Polyclonal antibody specifically detects WBSCR27 in Human samples. It is validated for ImmunofluorescenceSpecifications
WBSCR27 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
MGC40131, Williams Beuren syndrome chromosome region 27, Williams-Beuren syndrome chromosomal region 27 protein | |
This antibody was developed against Recombinant Protein corresponding to amino acids: RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL | |
25 μg | |
Cell Biology | |
155368 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction