Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR57 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | WDR57 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WDR57 Polyclonal specifically detects WDR57 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
WDR57 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
9410 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
Unconjugated | |
RUO | |
Human, Mouse, Rat | |
38 kDa-splicing factor, HPRP8BP, Prp8-binding protein, PRP8BP40K, PRPF8BPFLJ41108, RP11-490K7.3, SFP38, small nuclear ribonucleoprotein 40kDa (U5), SPF38MGC1910, U5 small nuclear ribonucleoprotein 40 kDa protein, U5 snRNP 40 kDa protein, U5 snRNP-specific 40 kDa protein, U5 snRNP-specific 40 kDa protein (hPrp8-binding), U5-40K, U5-40kD protein, WD repeat domain 57 (U5 snRNP specific), WD repeat-containing protein 57, WDR57 | |
SNRNP40 | |
IgG | |
Affinity Purified | |
Specificity of human WDR57 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title