Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR83OS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C19orf56 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WDR83OS Polyclonal specifically detects WDR83OS in Human samples. It is validated for Western Blot.Specifications
C19orf56 | |
Polyclonal | |
Rabbit | |
Q9Y284 | |
51398 | |
Synthetic peptides corresponding to C19ORF56 The peptide sequence was selected from the N terminal of C19ORF56. Peptide sequence STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C19orf56, chromosome 19 open reading frame 56, hypothetical protein LOC51398, PTD008, WD repeat domain 83 opposite strand | |
WDR83OS | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title