WDR9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154801

Catalog No. NBP154801

Description

WDR9 Polyclonal specifically detects WDR9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: WDR9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bromodomain and WD repeat domain containing 1, bromodomain and WD repeat-containing protein 1, C21orf107, chromosome 21 open reading frame 107, FLJ11315, FLJ43918, N143, transcriptional unit N143, WD repeat domain 9, WD repeat protein WDR9-form2, WD repeat-containing protein 9, WDR9
• Host Species: Rabbit
• Molecular Weight of Antigen: 13 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6P2D1
• Gene Symbols: BRWD1
• Immunogen: Synthetic peptides corresponding to BRWD1(bromodomain and WD repeat domain containing 1) The peptide sequence was selected from the N terminal of BRWD1. Peptide sequence MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54014
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.