WNK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25843825UL

Catalog No. NB393450

Description

WNK1 Polyclonal specifically detects WNK1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: WNK1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 2.7.11, EC 2.7.11.1, Erythrocyte 65 kDa protein, HSAN2hereditary sensory neuropathy, type II, HSN2MGC163339, hWNK1, KDPMGC163341, KIAA0344, Kinase deficient protein, p65, PHA2C, PRKWNK1PSK, prostate-derived sterile 20-like kinase, Protein kinase lysine-deficient 1, Protein kinase with no lysine 1, protein kinase, lysine deficient 1, serine/threonine-protein kinase WNK1, WNK lysine deficient protein kinase 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: WNK1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA
• Quantity: 25 μL
• Research Discipline: Protein Kinase, Signal Transduction, Transcription Factors and Regulators
• Gene ID (Entrez): 65125
• Target Species: Human
• Isotype: IgG

For Research Use Only