Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WNK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | WNK1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WNK1 Polyclonal specifically detects WNK1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
WNK1 | |
Polyclonal | |
Rabbit | |
Protein Kinase, Signal Transduction, Transcription Factors and Regulators | |
EC 2.7.11, EC 2.7.11.1, Erythrocyte 65 kDa protein, HSAN2hereditary sensory neuropathy, type II, HSN2MGC163339, hWNK1, KDPMGC163341, KIAA0344, Kinase deficient protein, p65, PHA2C, PRKWNK1PSK, prostate-derived sterile 20-like kinase, Protein kinase lysine-deficient 1, Protein kinase with no lysine 1, protein kinase, lysine deficient 1, serine/threonine-protein kinase WNK1, WNK lysine deficient protein kinase 1 | |
WNK1 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
65125 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title