Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Wnt-9b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
Antigen | Wnt-9b |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15793720
![]() |
Novus Biologicals
NBP15793720UL |
20 μL |
Each for $158.00
|
|
|||||
NBP157937
![]() |
Novus Biologicals
NBP157937 |
100 μL |
Each for $487.50
|
|
|||||
Description
Wnt-9b Polyclonal specifically detects Wnt-9b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Wnt-9b | |
Polyclonal | |
Purified | |
RUO | |
Human | |
Protein Wnt-14b, wingless-type MMTV integration site family, member 15, wingless-type MMTV integration site family, member 9B, WNT14Bprotein Wnt-9b, WNT15Protein Wnt-15 | |
WNT9B | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Signal Transduction, Wnt Signaling Pathway | |
O14905 | |
7484 | |
Synthetic peptides corresponding to WNT9B (wingless-type MMTV integration site family, member 9B) The peptide sequence was selected from the C terminal of WNT9B. Peptide sequence FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD. | |
Primary | |
39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title