Wnt3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156996

Catalog No. NBP156996

Description

Wnt3 Polyclonal specifically detects Wnt3 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Wnt3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: INT4Proto-oncogene Int-4 homolog, MGC131950, MGC138321, MGC138323, proto-oncogene Wnt-3, wingless-type MMTV integration site family, member 3, WNT-3 proto-oncogene protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Signaling Pathway, Wnt Signaling Pathway
• Gene ID (Entrez): 7473
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P56703
• Gene Symbols: WNT3
• Immunogen: Synthetic peptides corresponding to WNT3 (wingless-type MMTV integration site family, member 3) The peptide sequence was selected from the middle region of WNT3 (NP_110380). Peptide sequence SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%; Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG