Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Wnt3 Antibody, Novus Biologicals™

Wnt3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15699620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15699620 20 μL
NBP156996 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15699620 Supplier Novus Biologicals Supplier No. NBP15699620UL

Description

Rabbit Polyclonal Antibody

Wnt3 Polyclonal specifically detects Wnt3 in Human samples. It is validated for Western Blot.

Specifications

Antigen Wnt3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P56703
Gene Alias INT4Proto-oncogene Int-4 homolog, MGC131950, MGC138321, MGC138323, proto-oncogene Wnt-3, wingless-type MMTV integration site family, member 3, WNT-3 proto-oncogene protein
Gene Symbols WNT3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to WNT3 (wingless-type MMTV integration site family, member 3) The peptide sequence was selected from the middle region of WNT3 (NP_110380). Peptide sequence SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNE.
Molecular Weight of Antigen 43 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Stem Cell Signaling Pathway, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 7473
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.