Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Wnt3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15699620UL
Description
Wnt3 Polyclonal specifically detects Wnt3 in Human samples. It is validated for Western Blot.Specifications
Wnt3 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
P56703 | |
WNT3 | |
Synthetic peptides corresponding to WNT3 (wingless-type MMTV integration site family, member 3) The peptide sequence was selected from the middle region of WNT3 (NP_110380). Peptide sequence SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNE. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
INT4Proto-oncogene Int-4 homolog, MGC131950, MGC138321, MGC138323, proto-oncogene Wnt-3, wingless-type MMTV integration site family, member 3, WNT-3 proto-oncogene protein | |
Rabbit | |
43 kDa | |
20 μL | |
Stem Cell Signaling Pathway, Wnt Signaling Pathway | |
7473 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction