Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WRCH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158350
Description
WRCH1 Polyclonal specifically detects WRCH1 in Human samples. It is validated for Western Blot.Specifications
WRCH1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ARHU, CDC42L1GTP-binding protein-like 1, DJ646B12.2, fJ646B12.2, FLJ10616,2310026M05Rik, G28K, GTP-binding protein like 1, GTP-binding protein SB128, hG28K, ras homolog gene family, member U, ras-like gene family member U, Rho GTPase-like protein ARHU, rho-related GTP-binding protein RhoU, Ryu GTPase, Wnt-1 responsive Cdc42 homolog 1, WRCH-1, WRCH1CDC42-like GTPase 1 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Chicken: 92%; Mouse: 92%; Guinea pig: 78%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q7L0Q8 | |
RHOU | |
Synthetic peptides corresponding to RHOU(ras homolog gene family, member U) The peptide sequence was selected from the C terminal of RHOU. Peptide sequence LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV. | |
100 μL | |
Cell Biology, Signal Transduction | |
58480 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction