Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WWOX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP24757925UL
Description
WWOX Polyclonal specifically detects WWOX in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunoblotting.Specifications
WWOX | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunoblotting | |
D16S432E, EC 1.1.1, EC 1.1.1.-, FORHHCMA56, FRA16D, Fragile site FRA16D oxidoreductase, SDR41C1, short chain dehydrogenase/reductase family 41C, member 1, WOX1PRO0128, WW domain containing oxidoreductase, WW domain-containing oxidoreductase, WW domain-containing protein WWOX | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoblot | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
WWOX | |
This antibody was developed against a recombinant protein corresponding to amino acids: VYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGS | |
25 μL | |
Alzheimers Research, Apoptosis, Cancer, Neuroscience, Tumor Suppressors | |
51741 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction