Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WWOX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$405.00 - $670.00
Specifications
| Antigen | WWOX |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoblot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WWOX Polyclonal specifically detects WWOX in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunoblotting.Specifications
| WWOX | |
| Polyclonal | |
| Rabbit | |
| Alzheimers Research, Apoptosis, Cancer, Neuroscience, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51741 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoblot | |
| Unconjugated | |
| RUO | |
| Human | |
| D16S432E, EC 1.1.1, EC 1.1.1.-, FORHHCMA56, FRA16D, Fragile site FRA16D oxidoreductase, SDR41C1, short chain dehydrogenase/reductase family 41C, member 1, WOX1PRO0128, WW domain containing oxidoreductase, WW domain-containing oxidoreductase, WW domain-containing protein WWOX | |
| WWOX | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title